PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00003.1.g13870.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 458aa    MW: 49660.5 Da    PI: 10.1489
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00003.1.g13870.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_122.82.1e-073163581557
                                   HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1  15 eAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                                   ++A rs +RK  +i++Le+kv+ L++e ++L  +l  l+  +a
  Zjn_sc00003.1.g13870.1.am.mk 316 ISAARSKERKMRYIAKLEQKVQILQTEATTLSAQLTLLQRDSA 358
                                   69********************************999987766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.4E-4310366IPR004827Basic-leucine zipper domain
CDDcd147031.19E-14316358No hitNo description
SuperFamilySSF579594.1E-6316356No hitNo description
Gene3DG3DSA:1.20.5.1701.0E-6316357No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MHFPPVAGLT NAQLPTAGVL QSQYLQDLAK AKLALHSTVP AASPGTAQTA ARHAASATLL  60
AERLLLVTSR PPGEHTKGPR KGNETKTGCR GERSSQCRRG EQRLATPPQG PPPLPHEGGT  120
TKRRLNTHKS ARPAKHRSIR SHRRAPLPPR AADACMDVEH AARKAAAHRR SRSDVPLGYF  180
PPPKVEAGLG GHHDADDLFT AFLNLEGLDG LHNPSDERHD DGDRDSRGSS MKMTNGADSS  240
ENESEEGAAD DRRPAGVRLW TADAINRLEG LNVKRSAAGE PSTAPTVRHA RSLSVDSLIG  300
KFNFSAGGTT SATSGISAAR SKERKMRYIA KLEQKVQILQ TEATTLSAQL TLLQRDSAGI  360
ATQNNELKFR LQAMERQAQL RDALNEALTA EVQRLKLATA ELGDSCSSNN IVQQIQLNVQ  420
EQMFQLQKQQ QQQATPIPFY QLQQPQQSGA AKNHESEE
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9715091e-108EU971509.1 Zea mays clone 366380 DNA binding protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985885.11e-131PREDICTED: transcription factor RF2b-like
TrEMBLK4AAD41e-131K4AAD4_SETIT; Uncharacterized protein
STRINGSi035841m1e-130(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.32e-25bZIP family protein